1.67 Rating by ClearWebStats

a1mccormicklandscapeandlawnservice.com has registered 5 months 3 weeks ago. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, a1mccormicklandscapeandlawnservice.com is SAFE to browse.

Get Custom Widget

Traffic Report for a1mccormicklandscapeandlawnservice.com

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
DMOZ Listing: No
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Where is a1mccormicklandscapeandlawnservice.com server located?

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:

a1mccormicklandscapeandlawnservice.com search engine traffic

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

Local Internet Marketing by BrandRep

- brandrep.com

BrandRep is a local seo and local internet marketing company that partners with thousands of local businesses to market to local customers. We offer services from local seo, to...

  415,804   $ 5,760.00

Courier in Houston, TX | Crosstown Couriers (832) 919-3506

- courierhouston.com

Crosstown Couriers in Houston, TX specializes in courier service, notary public service, shipping service, & more. Call (832) 919-3506 for a courier that does legal documents...

  Not Applicable   $ 8.95

Transportation Company

- amarillotaxiservice.com

AJ's Taxi Service is a transportation company located in Amarillo, TX specializing in medical deliveries, transportation services, courier services, & more. Call (806) 444-8622...

  Not Applicable   $ 8.95

Portraits in Dallas, TX | Cameron Spooner Photography (214) 686-1732

- portraitsdallas.com

Cameron Spooner Photography in Dallas, TX specializes in portraits, dance photography, & more. Call (214) 686-1732 for a commercial photographer and fashion photographer that...

  Not Applicable   $ 8.95

Insurance Company

- insuranceherndon.com

Nationwide Insurance - Griffin-Owens Insurance Group is an insurance company located in Herndon, VA specializing in life insurance, health insurance, condo insurance, & more....

  Not Applicable   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.6.0
Date: Mon, 24 Apr 2017 14:11:47 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
ETag: "0f4c38db7e400647c12f1d1f07fe4ff2"
Cache-Control: max-age=0, private, must-revalidate
X-Request-Id: 8a622627-ceef-436d-9d25-437f35dec68e
X-Runtime: 0.004561
X-Powered-By: Phusion Passenger

Domain Information for a1mccormicklandscapeandlawnservice.com

Domain Registrar: GODADDY.COM, LLC
Registration Date: 2017-02-27 5 months 3 weeks 2 hours ago
Last Modified: 2017-03-09 5 months 1 week 4 days ago
Expiration Date: 2018-02-27 6 months 21 hours 29 minutes from now

Domain Nameserver Information

Host IP Address Country
ns11.domaincontrol.com United States United States
ns12.domaincontrol.com United States United States

DNS Record Analysis

Host Type TTL Extra
a1mccormicklandscapeandlawnservice.com A 598 IP:
a1mccormicklandscapeandlawnservice.com NS 3600 Target: ns11.domaincontrol.com
a1mccormicklandscapeandlawnservice.com NS 3600 Target: ns12.domaincontrol.com
a1mccormicklandscapeandlawnservice.com SOA 600 MNAME: ns11.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2017030800
Refresh: 28800
Retry: 7200
Expire: 604800
a1mccormicklandscapeandlawnservice.com MX 3600 Target: smtp.secureserver.net
a1mccormicklandscapeandlawnservice.com MX 3600 Priority: 10
Target: mailstore1.secureserver.net

Similarly Ranked Websites to a1mccormicklandscapeandlawnservice.com


- google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

  1   $ 8,833,062,960.00

Google Calendar

- calendar.google.com

With Google's free online calendar, it’s easy to keep track of life’s important events all in one place.

  1   $ 8,833,062,960.00


- mail.google.com

Gmail is email that's intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

  1   $ 8,833,062,960.00

Google Play

- play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

  1   $ 8,833,062,960.00

Chrome Web Browser

- chrome.google.com

A fast, secure, and free web browser built for the modern web. Chrome syncs bookmarks across all your devices, fills out forms automatically, and so much more.

  1   $ 8,833,062,960.00

Competitive search data from SEMrush

a1mccormicklandscapeandlawnservice.com search engine traffic graph

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup for a1mccormicklandscapeandlawnservice.com

Domain Name: a1mccormicklandscapeandlawnservice.com
Registrar URL:
Registrant Name: BrandRep
Registrant Organization: BrandRep
Name Server:
Name Server:
DNSSEC: unsigned

For complete
domain details go

The data contained in GoDaddy.com,
LLC's WhoIs database,
while believed by the company to be
reliable, is provided "as is"
with no guarantee or warranties
regarding its accuracy. This
information is provided for the sole
purpose of assisting you
in obtaining information about domain
name registration records.
Any use of this data for any other
purpose is expressly forbidden without the prior
permission of GoDaddy.com, LLC. By submitting an
you agree to these terms of usage and limitations of
warranty. In particular,
you agree not to use this data to allow,
enable, or otherwise make possible,
dissemination or collection of
this data, in part or in its entirety, for any
purpose, such as
the transmission of unsolicited advertising and
and solicitations
of any kind, including spam. You further agree
not to use this
data to enable high volume, automated or robotic
processes designed to collect or compile this data for
any purpose,
including mining this data for your own personal or
commercial purposes.

Please note: the registrant of the
domain name is specified
in the "registrant" section. In most
cases, GoDaddy.com, LLC
is not the registrant of domain names
listed in this database.

Like a1mccormicklandscapeandlawnservice.com ? Comment / rate / feedback below